CATH Domain: 1k32A05 XML data for domain: 1k32A05

Molscript image for 1k32A05
1k32A05
PDB coordinates for domain 1k32A05

PDB 1k32, Chain A, Domain 5

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.226 2-enoyl-CoA Hydratase; Chain A, domain 1
3.90.226.10 2-enoyl-CoA Hydratase; Chain A, domain 1 Gene3D
3.90.226.10.11
3.90.226.10.11.1
3.90.226.10.11.1.1
3.90.226.10.11.1.1.1
3.90.226.10.11.1.1.1.1

Segment boundaries for domain 1k32A05

Chopping figure for domain 1k32A05
DomainStart PDB ResidueStop PDB Residue
1k32A01 39 310
1k32A02 326 675
1k32A03 681 752
1k32A04 761 855
1k32A05 856 1061

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|1k32A05
RFIRYRSWVEANRRYVHERSKGTIGYIHIPDMGMMGLNEFYRLFINESSYQGLIVDVRFNGGGFVSQLIIEKLMNKRIGY
DNPRRGTLSPYPTNSVRGKIIAITNEYAGSDGDIFSFSFKKLGLGKLIGTRTWGGVVGITPKRRLIDGTVLTQPEFAFWF
RDAGFGVENYGVDPDVEIEYAPHDYLSGKDPQIDYAIDALIEELRN    

Domain COMBS Sequence

>pdb|1k32A05
RFIRYRSWVEANRRYVHERSKGTIGYIHIPDMGMMGLNEFYRLFINESSYQGLIVDVRFNGGGFVSQLIIEKLMNKRIGY
DNPRRGTLSPYPTNSVRGKIIAITNEYAGSDGDIFSFSFKKLGLGKLIGTRTWGGVVGITPKRRLIDGTVLTQPEFAFWF
RDAGFGVENYGVDPDVEIEYAPHDYLSGKDPQIDYAIDALIEELRNWNEELPQRPS    

Domain History Events (22)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1k32A05 to 3.90.226.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1k32A05 (from the previous chopping at "Sun Mar 5 17:01:33 2006") which was in 3.90.226.10 at the time the chain was unchopped.

Update comment by auto on 09 Jan 2007 11:44

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 07:38

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 03:39

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 23:42

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 20:17

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 15:37

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 11:39

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 07:32

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 03:33

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 23:26

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 15:43

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:44

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 07:35

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 03:47

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2007 23:41

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Jan 2007 23:40

Domain "1k32A05" hits Domain "1k32F05" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Jan 2007 23:40

NW result present for Domain "1k32A05"

Flow stage update by auto on 23 Dec 2006 15:28

All required files are present for Domain "1k32A05"

Flow stage update by auto on 22 Dec 2006 15:43

Beginning processing for Domain "1k32A05"

Insertion by cuff on 22 Dec 2006 15:02

two choppings