Set cath from cathlist by auto on 05 Mar 2006 19:33
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 8 matching structural neighberhood comparisons for CATH ID 3.90.79.10.11.1.1.1.1 (SIMAX score < 5)
>pdb|1k2eA00 MIVTSGVLVENGKVLLVKHKRLGVYIYPGGHVEHNETPIEAVKREFEEETGIVVEPIGFTYGIIDENAVERPMPLVILEE VVKYPEETHIHFDLIYLVKRVGGDLKNGEWIDVREIDRIETFPNVRKVVSLALSTLYRLGKISKLAAALEHH
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"