CATH Domain: 1k0rA04 XML data for domain: 1k0rA04

Molscript image for 1k0rA04
1k0rA04
PDB coordinates for domain 1k0rA04

PDB 1k0r, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.6
3.30.300.20.6.1
3.30.300.20.6.1.1
3.30.300.20.6.1.1.1
3.30.300.20.6.1.1.1.2

[top]
Segment boundaries for domain 1k0rA04

Chopping figure for domain 1k0rA04
DomainStart PDB ResidueStop PDB Residue
1k0rA01 1 99
1k0rA02 108 182
1k0rA03 183 261
1k0rA04 262 329

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.30.300.20.6.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3gkuA02 79.35 Clostridium symbiosum ATCC 14940Probable RNA-binding protein 3.30.300.120 77 8 81 3.36 4.11
2vqeC01 79.22 RibosomeThermus thermophilus HB8Small subunit ribosomal protein S330S ribosomal protein S3 3.30.300.20 91 13 70 2.28 3.24
2qmwA03 78.04 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysPrephenate dehydratase [EC:4.2.1.51]Similar to chorismate mutaseStaphylococcus aureus subsp. aureus Mu50 3.30.70.260 73 6 79 3.34 4.20
1mwyA00 76.86 Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]Detoxification of zinc ionLead, cadmium, zinc and mercury-transporting ATPaseEscherichia coli K-12Response to cadmium ion 3.30.70.100 73 16 76 3.40 4.43
1osdA00 76.76 Hypothetical periplasmic mercuric ion binding proteinCupriavidus metallidurans CH34 3.30.70.100 72 12 76 3.81 4.99
1pa4A00 73.46 Ribosome-binding factor AMycoplasma pneumoniaeRibosome-binding factor A 3.30.300.20 96 11 69 3.20 4.59
3dxsX00 73.27 Cu2+-exporting ATPase [EC:3.6.3.4]Arabidopsis thalianaCopper-transporting ATPase RAN1Regulation of stomatal movementGolgi apparatus 3.30.70.100 66 10 68 3.40 5.00
1zpvB00 71.92 ACT domain-containing proteinUPF0237 protein SP_0238Streptococcus pneumoniae 3.30.70.260 81 9 82 4.12 4.98
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1k0rA04
DDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAPP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1k0rA04
DDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAPP
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 23 Aug 2007 22:15

Assigning to "3.30.300.20" based on similarity with "1k0rB04"

Flow stage update by auto on 23 Aug 2007 22:10

No in_process hits for Domain "1k0rA04" ready to be processed

Update comment by auto on 23 Aug 2007 18:44

Domain "1k0rA04" hits Domain "1k0rB04" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Aug 2007 18:41

Domain "1k0rA04" hits Domain "1k0rB04" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Aug 2007 18:40

NW result present for Domain "1k0rA04"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "1k0rA04"

Flow stage update by auto on 18 Aug 2007 20:23

Beginning processing for Domain "1k0rA04"

Insertion by auto on 18 Aug 2007 18:25

Final ChopClose added based on similarity with "1k0rB"