CATH Domain: 1k0rA03 XML data for domain: 1k0rA03

Molscript image for 1k0rA03
1k0rA03
PDB coordinates for domain 1k0rA03

PDB 1k0r, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.4
3.30.300.20.4.1
3.30.300.20.4.1.1
3.30.300.20.4.1.1.1
3.30.300.20.4.1.1.1.2

[top]
Segment boundaries for domain 1k0rA03

Chopping figure for domain 1k0rA03
DomainStart PDB ResidueStop PDB Residue
1k0rA01 1 99
1k0rA02 108 182
1k0rA03 183 261
1k0rA04 262 329

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.300.20.4.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2asbA03 87.41 N utilization substance protein ATranscription elongation protein nusAMycobacterium tuberculosis 3.30.300.20 72 18 81 2.24 2.77
3gkuA02 81.49 Clostridium symbiosum ATCC 14940Probable RNA-binding protein 3.30.300.120 77 9 88 3.26 3.68
1egaA02 80.47 GTP-binding protein EraGTP-binding protein eraEscherichia coli K-12 3.30.300.20 106 13 67 2.59 3.81
3h90A02 80.15 Ferrous-iron efflux pump FieFCellular cadmium ion homeostasisCellular zinc ion homeostasisCadmium ion transportEscherichia coli K-12 3.30.70.1350 84 7 83 2.82 3.38
1pa4A00 76.48 Ribosome-binding factor AMycoplasma pneumoniaeRibosome-binding factor A 3.30.300.20 96 8 76 3.26 4.29
2rhsD06 75.95 Aminoacyl-tRNA biosynthesisStaphylococcus haemolyticus JCSC1435Phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]Phenylalanyl-tRNA synthetase beta chain 3.30.70.380 88 5 76 3.43 4.51
2jmpA01 73.79 Two-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaAMycoplasma genitalium 3.30.300.20 87 5 83 4.14 4.93
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1k0rA03
RTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1k0rA03
RTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYD
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 23 Aug 2007 22:15

Assigning to "3.30.300.20" based on similarity with "1k0rB03"

Flow stage update by auto on 23 Aug 2007 22:10

No in_process hits for Domain "1k0rA03" ready to be processed

Update comment by auto on 23 Aug 2007 18:44

Domain "1k0rA03" hits Domain "1k0rB03" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Aug 2007 18:41

Domain "1k0rA03" hits Domain "1k0rB03" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Aug 2007 18:40

NW result present for Domain "1k0rA03"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "1k0rA03"

Flow stage update by auto on 18 Aug 2007 20:23

Beginning processing for Domain "1k0rA03"

Insertion by auto on 18 Aug 2007 18:25

Final ChopClose added based on similarity with "1k0rB"