CATH Domain: 1k0oB02 XML data for domain: 1k0oB02

Molscript image for 1k0oB02
1k0oB02
PDB coordinates for domain 1k0oB02

PDB 1k0o, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.15
1.20.1050.10.15.1
1.20.1050.10.15.1.1
1.20.1050.10.15.1.1.1
1.20.1050.10.15.1.1.1.1

[top]
Segment boundaries for domain 1k0oB02

Chopping figure for domain 1k0oB02
DomainStart PDB ResidueStop PDB Residue
1k0oB01 6 97
1k0oB02 98 241

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eemA02 83.65 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 10 82 2.36 2.85
2vo4A02 83.55 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 14 90 2.84 3.15
1gwcA02 83.01 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 13 84 2.44 2.89
1v2aA02 82.75 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 14 84 2.84 3.38
2pvqA02 82.52 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 14 73 2.42 3.27
1hqoA02 82.22 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 13 74 2.56 3.43
1n2aA02 81.81 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 13 73 2.83 3.87
1aw9A02 81.80 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 19 81 2.71 3.33
2dsaA02 81.28 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 14 74 2.76 3.69
1dugA02 81.17 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 19 75 3.09 4.09
1gnwA02 80.99 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 13 80 2.95 3.69
3cbuA02 79.20 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 15 81 3.84 4.69
2gsqA02 77.68 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 16 73 3.48 4.70
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1k0oB02
ALSNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFT
IPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1k0oB02
ALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNELTLAD
CNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"