CATH Domain: 1jykA00 XML data for domain: 1jykA00

Molscript image for 1jykA00
1jykA00
PDB coordinates for domain 1jykA00

PDB 1jyk, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.550 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
3.90.550.10 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Gene3D
3.90.550.10.8
3.90.550.10.8.1
3.90.550.10.8.1.1
3.90.550.10.8.1.1.1
3.90.550.10.8.1.1.1.1

[top]
Segment boundaries for domain 1jykA00

Chopping figure for domain 1jykA00
DomainStart PDB ResidueStop PDB Residue
1jykA00 3 231

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.90.550.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i52A00 79.59 Terpenoid backbone biosynthesisMetabolic pathways2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 3.90.550.10 225 11 87 4.32 4.95
1e5kA00 78.15 Molybdopterin-guanine dinucleotide biosynthesis protein AEscherichia coli K-12Molybdopterin-guanine dinucleotide biosynthesis protein A 3.90.550.10 188 9 77 3.66 4.69
2qh5B00 76.61 Amino sugar and nucleotide sugar metabolismHelicobacter pyloriMannose-1-phosphate guanylyltransferase [EC:2.7.7.22]Fructose and mannose metabolismMannose-6-phosphate isomerase (Pmi) or (AlgA) 3.90.550.10 254 11 77 3.38 4.38
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jykA00
EIRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDYLKEKYGVRLVFNDKY
ADYNNFYSLYLVKEELANSYVIDADNYLFKNFRNDLTRSTYFSVYREDCTNEWFLVYGDDYKVQDIIVDSKAGRILSGVS
FWDAPTAEKIVSFIDKAYVSGEFVDLYWDNVKDNIKELDVYVEELEGNSIYEIDSVQDYRKLEEILK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jykA00
EIRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDYLKEKYGVRLVFNDKY
ADYNNFYSLYLVKEELANSYVIDADNYLFKNXFRNDLTRSTYFSVYREDCTNEWFLVYGDDYKVQDIIVDSKAGRILSGV
SFWDAPTAEKIVSFIDKAYVSGEFVDLYWDNXVKDNIKELDVYVEELEGNSIYEIDSVQDYRKLEEILKNEN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:58

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"