Set cath from cathlist by auto on 05 Mar 2006 19:36
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 1 matching structural neighberhood comparisons for CATH ID 3.90.730.10.5.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1bolA00 | 85.17 | 3.90.730.10 | 222 | 24 | 80 | 2.63 | 3.28 |
>pdb|1jy5A00 HKEFDYFTLALTWSGTECLSCPTNACSRSEVETGFTIKGLWPDYDDGTWPSCCEGAKYDQNEISILSNDLSKYWPSYSCP SSSACGSFDASDLAYEWAKHGTCSSPVLGNQYEYFSTTLMLYFKYNISEILSESGYLPSNTAEYKVEGIMSAIQSALRVT PVVKCKSDAVEQVQICFDKTLQLQECPSTASTCPSLVSLPIKN
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"