CATH Domain: 1jwoA00 XML data for domain: 1jwoA00

Molscript image for 1jwoA00
1jwoA00
PDB coordinates for domain 1jwoA00

PDB 1jwo, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.3
3.30.505.10.3.2
3.30.505.10.3.2.1
3.30.505.10.3.2.1.1
3.30.505.10.3.2.1.1.1

[top]
Segment boundaries for domain 1jwoA00

Chopping figure for domain 1jwoA00
DomainStart PDB ResidueStop PDB Residue
1jwoA00 117 213

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 3.30.505.10.3.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nrvA00 92.17 CytoplasmInsulin receptor bindingGrowth factor receptor-bound protein 10Plasma membranePositive regulation of phosphorylation 3.30.505.10 100 28 94 1.22 1.30
2oq1A03 90.79 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 99 35 92 1.35 1.45
1opkA02 90.72 Protein domain specific bindingNucleusManganese ion bindingPeptidyl-tyrosine phosphorylationMus musculus 3.30.505.10 102 37 87 1.31 1.50
2oq1A01 89.47 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 28 88 1.97 2.22
2dm0A01 88.48 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 30 86 1.33 1.53
3c7iA00 88.34 Jak-STAT signaling pathwayNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.505.10 101 29 92 2.57 2.79
2iugA00 88.28 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 27 89 2.90 3.26
2crhA01 88.24 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 28 91 1.77 1.94
1i3zA00 87.99 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 32 89 2.35 2.63
1qadA00 87.91 Jak-STAT signaling pathwayAldosterone-regulated sodium reabsorptionNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.505.10 104 31 89 4.11 4.60
2shpA02 87.48 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 33 86 2.02 2.35
1ayaA00 87.41 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 30 89 2.15 2.41
1milA00 87.21 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 30 92 2.36 2.56
1r1pB00 86.99 GRB2-related adaptor protein 2Mus musculusT cell receptor signaling pathwayProtein binding 3.30.505.10 100 25 89 2.39 2.69
3bkbA01 86.59 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 26 89 3.80 4.23
2kk6A00 86.11 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 34 81 2.68 3.27
2vifA01 83.46 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 31 77 3.13 4.02
3buxB03 83.03 Jak-STAT signaling pathwayPathways in cancerT cell receptor signaling pathwayErbB signaling pathwayChronic myeloid leukemia 3.30.505.10 86 13 77 2.97 3.83
1ju5A00 82.81 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 33 81 2.64 3.23
2pldA00 82.37 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 27 91 3.90 4.27
1uurA04 78.13 Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol 3.30.505.10 132 12 63 2.90 4.56
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jwoA00
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHY
SKDKGAICTKLVRPKRK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jwoA00
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHY
SKDKGAICTKLVRPKRK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"