CATH Domain: 1jvaB02 XML data for domain: 1jvaB02

Molscript image for 1jvaB02
1jvaB02
PDB coordinates for domain 1jvaB02

PDB 1jva, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.28 Endonuclease I-creI
3.10.28.10 Homing endonucleases Gene3D
3.10.28.10.6
3.10.28.10.6.1
3.10.28.10.6.1.1
3.10.28.10.6.1.1.1
3.10.28.10.6.1.1.1.1

Segment boundaries for domain 1jvaB02

Chopping figure for domain 1jvaB02
DomainStart PDB ResidueStop PDB Residue
1jvaB01 279 462
1jvaB01 699 741
1jvaB02 466 586
1jvaB03 587 681

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.28.10.6.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vs7A02 76.71 Desulfurococcus mobilisHoming endonuclease I-DmoI 3.10.28.10 78 11 69 3.27 4.73
1dq3A03 74.82 Pyrimidine metabolismPyrococcus furiosusPurine metabolismRibonucleoside-diphosphate reductaseRibonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1] 3.10.28.10 87 14 64 2.49 3.86
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|1jvaB02
LYENDHFFDYMQKSKFHLTIEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQVAK
TVNLYSLNTENPLWDAIVGLGFLKDGVKNI    

Domain COMBS Sequence

>pdb|1jvaB02
LYENDHFFDYMQKSKFHLTIEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQVAK
TVNLYSKVVRGNGIRNNLNTENPLWDAIVGLGFLKDGVKNI    

Domain History Events (12)

Domain assigned by auto on 20 Oct 2008 14:27

Assigning to "3.10.28.10" based on similarity with "1ef0A02"

Flow stage update by auto on 20 Oct 2008 14:23

No in_process hits for Domain "1jvaB02" ready to be processed

Update comment by auto on 20 Oct 2008 14:09

Domain "1jvaB02" hits Domain "1ef0A02" (100% over 100%) which is currently in process

Update comment by auto on 23 Jul 2008 18:03

Domain "1jvaB02" hits Domain "1dfaA02" (100% over 85.9504132231405%) which is currently in process

Update comment by auto on 03 Sep 2007 20:11

Domain "1jvaB02" hits Domain "1dfaA02" (100% over 85.9504132231405%) which is currently in process

Update comment by auto on 03 Sep 2007 11:18

Domain "1jvaB02" hits Domain "1dfaA02" (100% over 85.9504132231405%) which is currently in process

Update comment by auto on 23 Aug 2007 18:44

Domain "1jvaB02" hits Domain "1dfaA02" (100% over 85.9504132231405%) which is currently in process

Flow stage update by auto on 23 Aug 2007 18:41

Domain "1jvaB02" hits Domain "1dfaA02" (100% over 85.9504132231405%) which is currently in process

Flow stage update by auto on 23 Aug 2007 18:40

NW result present for Domain "1jvaB02"

Flow stage update by auto on 22 Aug 2007 10:08

All required files are present for Domain "1jvaB02"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "1jvaB02"

Insertion by auto on 21 Aug 2007 16:04

Final ChopClose added based on similarity with "1jvaA"