CATH Domain: 1juvA00 XML data for domain: 1juvA00

Molscript image for 1juvA00
1juvA00
PDB coordinates for domain 1juvA00

PDB 1juv, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.7
3.40.430.10.7.1
3.40.430.10.7.1.1
3.40.430.10.7.1.1.1
3.40.430.10.7.1.1.1.1

[top]
Segment boundaries for domain 1juvA00

Chopping figure for domain 1juvA00
DomainStart PDB ResidueStop PDB Residue
1juvA00 1 193

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.430.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ix9A00 83.75 One carbon pool by folateDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3]Metabolic pathways 3.40.430.10 166 25 81 2.43 2.99
1qzfA01 83.56 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 17 83 3.83 4.59
1cz3B00 82.05 Thermotoga maritimaDihydrofolate reductase 3.40.430.10 168 14 81 3.65 4.49
2bl9A00 81.98 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 17 77 3.35 4.33
2fziA00 81.43 Pneumocystis cariniiDihydrofolate reductase 3.40.430.10 206 19 79 3.28 4.12
1vdrA00 80.01 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 19 80 3.17 3.95
2hxvA02 79.43 Riboflavin metabolismMetabolic pathwaysThermotoga maritimaDiaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]Riboflavin-specific deaminase 3.40.430.10 193 10 83 3.89 4.66
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1juvA00
MIKLVFRYSPTKTVDGFNELAFGLGDGLPWGRVKKDLQNFKARTEGTIMIMGAKTFQSLPTLLPGRSHIVVCDLARDYPV
TKDGDLAHFYITWEQYITYISGGEIQVSSPNAPFETMLDQNSKVSVIGGPALLYAALPYADEVVVSRIVKRHRVNSTVQL
DASFLDDISKREMVETHWYKIDEVTTLTESVYK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1juvA00
MIKLVFRYSPTKTVDGFNELAFGLGDGLPWGRVKKDLQNFKARTEGTIMIMGAKTFQSLPTLLPGRSHIVVCDLARDYPV
TKDGDLAHFYITWEQYITYISGGEIQVSSPNAPFETMLDQNSKVSVIGGPALLYAALPYADEVVVSRIVKRHRVNSTVQL
DASFLDDISKREMVETHWYKIDEVTTLTESVYK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"