Set cath from cathlist by auto on 05 Mar 2006 18:46
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ju3A01 | 5 | 145 |
| 1ju3A01 | 241 | 348 |
| 1ju3A02 | 357 | 574 |
| 1ju3A03 | 146 | 240 |
There are 2 matching structural neighberhood comparisons for CATH ID 2.60.120.260.18.1.1.2.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1mpxA03 | 88.26 | 2.60.120.260 | 234 | 32 | 88 | 2.57 | 2.92 | |
![]() |
1lnsA04 | 79.89 | 2.60.120.260 | 186 | 12 | 71 | 2.50 | 3.51 |
>pdb|1ju3A02 AYTPFYLGGSGAANTSTGGGTLSTSISGTESADTYLYDPADPVPSLGGTLLFHNGDNGPADQRPIHDRDDVLCYSTEVLT DPVEVTGTVSARLFVSSSAVDTDFTAKLVDVFPDGRAIALCDGIVRMRYRETLVNPTLIEAGEIYEVAIDMLATSNVFLP GHRIMVQVSSSNFPKYDRNSNTGGVIAREQLEEMCTAVNRIHRGPEHPSHIVLPIIKR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"