CATH Domain: 1js3A03 XML data for domain: 1js3A03

Molscript image for 1js3A03
1js3A03
PDB coordinates for domain 1js3A03

PDB 1js3, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.38
3.90.1150.10.38.2
3.90.1150.10.38.2.1
3.90.1150.10.38.2.1.1
3.90.1150.10.38.2.1.1.1

[top]
Segment boundaries for domain 1js3A03

Chopping figure for domain 1js3A03
DomainStart PDB ResidueStop PDB Residue
1js3A01 1 81
1js3A02 82 379
1js3A03 380 476

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.38.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jg8A02 86.78 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 6 90 2.73 3.00
1svvB02 83.09 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.90.1150.10 88 10 81 3.32 4.06
1eg5B01 82.11 Thermotoga maritimaThiamine metabolismCysteine desulfurase [EC:2.8.1.7]Aminotransferase, class V 3.90.1150.10 106 7 73 2.42 3.29
1m32A01 81.60 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 10 80 2.42 3.02
1d2fB01 80.50 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.90.1150.10 124 13 74 3.07 4.14
1uu2B01 79.79 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 9 66 2.07 3.10
1iugA01 79.65 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 7 81 2.35 2.90
2phcB01 79.06 Pyrococcus horikoshiiPutative uncharacterized protein PH0987 3.30.1360.40 83 7 72 3.26 4.48
1rv3A01 77.05 Oryctolagus cuniculusSerine hydroxymethyltransferase, cytosolic 3.90.1150.10 170 12 57 2.54 4.45
1ohvA01 75.93 Sus scrofaMitochondrial matrixSuccinate-semialdehyde dehydrogenase bindingProtein homodimerization activityPyridoxal phosphate binding 3.90.1150.10 166 7 53 2.15 4.01
1c4kA03 73.43 Lactobacillus sp. 30AOrnithine decarboxylase, inducible 3.90.1150.10 180 5 51 2.45 4.79
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1js3A03
KHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSDGLNEALLERINSARKIHLVPCRLRGQFVLRFAICSRKVESGH
VRLAWEHIRGLAAELLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1js3A03
KHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSDGLNEALLERINSARKIHLVPCRLRGQFVLRFAICSRKVESGH
VRLAWEHIRGLAAELLAAEEGKAEIKS
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 16:58

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"