Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1js3A01 | 1 | 81 |
| 1js3A02 | 82 | 379 |
| 1js3A03 | 380 | 476 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1js3A01 MNASDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKIIMPGVTHWHSPYFFAYF P
HomCheck 'New T' domains
HomCheck 'New T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"