Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1jp4A01 | 5 | 179 |
| 1jp4A02 | 180 | 308 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.190.80.5.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1lbvA02 | 84.01 | 3.40.190.80 | 114 | 14 | 85 | 2.80 | 3.28 | |
![]() |
3b8bA02 | 80.04 | 3.40.190.80 | 100 | 25 | 75 | 2.92 | 3.88 |
>pdb|1jp4A02 FQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVG GKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"