CATH Domain: 1josA00 XML data for domain: 1josA00

Molscript image for 1josA00
1josA00
PDB coordinates for domain 1josA00

PDB 1jos, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.2
3.30.300.20.2.1
3.30.300.20.2.1.1
3.30.300.20.2.1.1.1
3.30.300.20.2.1.1.1.1

[top]
Segment boundaries for domain 1josA00

Chopping figure for domain 1josA00
DomainStart PDB ResidueStop PDB Residue
1josA00 7 106

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.300.20.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ib8A01 80.10 Hypothetical proteinRibosome maturation factor rimPStreptococcus pneumoniae 3.30.300.70 83 9 78 3.26 4.18
3h90A02 78.03 Ferrous-iron efflux pump FieFCellular cadmium ion homeostasisCellular zinc ion homeostasisCadmium ion transportEscherichia coli K-12 3.30.70.1350 84 11 77 3.49 4.53
3gkuA02 77.92 Clostridium symbiosum ATCC 14940Probable RNA-binding protein 3.30.300.120 77 5 71 3.02 4.25
2hzcA00 76.45 Splicing factor U2AF 65 kDa subunitSpliceosomeSpliceosomal complexSplicing factor U2AF 65 kDa subunitEnzyme binding 3.30.70.330 87 6 73 3.59 4.92
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1josA00
RSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDEMAIEQGMKGLEKASPYIRSLLGKAM
RLRIVPEIRFIYDQSLVEGM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1josA00
MAREFKRSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDEMAIEQGMKGLEKASPYIRS
LLGKAMRLRIVPEIRFIYDQSLVEGM
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:28

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"