CATH Domain: 1jnrA02 XML data for domain: 1jnrA02

Molscript image for 1jnrA02
1jnrA02
PDB coordinates for domain 1jnrA02

PDB 1jnr, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.700 Flavocytochrome C3; Chain A, domain 1
3.90.700.10 Flavocytochrome C3; Chain A, domain 1 Gene3D
3.90.700.10.1
3.90.700.10.1.1
3.90.700.10.1.1.1
3.90.700.10.1.1.1.1
3.90.700.10.1.1.1.1.1

[top]
Segment boundaries for domain 1jnrA02

Chopping figure for domain 1jnrA02
DomainStart PDB ResidueStop PDB Residue
1jnrA01 12 261
1jnrA01 394 487
1jnrA01 615 634
1jnrA02 262 393
1jnrA03 488 608

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.700.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1chuA02 79.01 Nicotinate and nicotinamide metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismL-aspartate oxidase [EC:1.4.3.16]L-aspartate oxidase activity 3.90.700.10 104 12 75 3.50 4.67
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jnrA02
IPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALA
ELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jnrA02
IPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALA
ELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPY
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 16:57

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"