CATH Domain: 1jmsA03 XML data for domain: 1jmsA03

Molscript image for 1jmsA03
1jmsA03
PDB coordinates for domain 1jmsA03

PDB 1jms, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.460 Beta Polymerase; domain 2
3.30.460.10 Beta Polymerase, domain 2 Gene3D
3.30.460.10.11
3.30.460.10.11.1
3.30.460.10.11.1.1
3.30.460.10.11.1.1.1
3.30.460.10.11.1.1.1.1

[top]
Segment boundaries for domain 1jmsA03

Chopping figure for domain 1jmsA03
DomainStart PDB ResidueStop PDB Residue
1jmsA01 148 242
1jmsA02 243 301
1jmsA03 302 440
1jmsA04 441 509

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.460.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jajA01 76.43 Repair DNA polymerase XAfrican swine fever virus BA71V 3.30.460.10 105 18 69 3.10 4.44
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jmsA03
CVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDIL
ESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSEGKGWKAIRVDLVMCPY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jmsA03
CVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDIL
ESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKAIRVDLVMCPY
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:57

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"