Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1jmoA01 | 101 | 278 |
| 1jmoA01 | 378 | 426 |
| 1jmoA02 | 279 | 377 |
| 1jmoA02 | 427 | 477 |
There are 3 matching structural neighberhood comparisons for CATH ID 2.30.39.10.15.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1imvA01 | 88.91 | 2.30.39.10 | 169 | 28 | 84 | 2.73 | 3.25 | |
![]() |
1k9oI02 | 88.38 | 2.30.39.10 | 161 | 30 | 88 | 1.95 | 2.21 | |
![]() |
1hp7A01 | 83.40 | 2.30.39.10 | 95 | 24 | 63 | 1.64 | 2.59 |
>pdb|1jmoA02 SWVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQLTPRV VERWQKSMTNRTREVLLPKNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIYEHRTSCLLFMGRVANP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"