CATH Domain: 1jmoA01 XML data for domain: 1jmoA01

Molscript image for 1jmoA01
1jmoA01
PDB coordinates for domain 1jmoA01

PDB 1jmo, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.7
3.30.497.10.7.1
3.30.497.10.7.1.1
3.30.497.10.7.1.1.1
3.30.497.10.7.1.1.1.1

[top]
Segment boundaries for domain 1jmoA01

Chopping figure for domain 1jmoA01
DomainStart PDB ResidueStop PDB Residue
1jmoA01 101 278
1jmoA01 378 426
1jmoA02 279 377
1jmoA02 427 477

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.497.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wz9A01 87.09 CytoplasmCellular component movementP53 signaling pathwaySerpin peptidase inhibitor, clade B, member 5Homo sapiens 3.30.497.10 219 23 93 1.95 2.09
1imvA02 86.19 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 19 90 1.94 2.14
2b5tI01 84.90 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 29 86 2.18 2.53
1k9oI01 84.67 Manduca sextaAlaserpinProtein binding 3.30.497.10 215 19 90 2.14 2.36
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jmoA01
KSRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEITTIH
NLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALE
NIDPATQMMILNCIYFKGFKLEKNYNLVESLKLMGIRMLFDKNGNMAGISDQRIAIDLFKHQGTITV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jmoA01
KSRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEITTIH
NLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALE
NIDPATQMMILNCIYFKGFKLEKNYNLVESLKLMGIRMLFDKNGNMAGISDQRIAIDLFKHQGTITV
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:57

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"