CATH Domain: 1jlvA02 XML data for domain: 1jlvA02

Molscript image for 1jlvA02
1jlvA02
PDB coordinates for domain 1jlvA02

PDB 1jlv, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.14
1.20.1050.10.14.3
1.20.1050.10.14.3.1
1.20.1050.10.14.3.1.1
1.20.1050.10.14.3.1.1.1

[top]
Segment boundaries for domain 1jlvA02

Chopping figure for domain 1jlvA02
DomainStart PDB ResidueStop PDB Residue
1jlvA01 1 77
1jlvA02 78 207

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.14.3.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1v2aA02 89.99 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 29 90 1.66 1.84
1hqoA02 86.50 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 14 83 2.10 2.52
2dsaA02 86.49 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 18 80 1.93 2.40
2pvqA02 86.42 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 23 78 2.04 2.61
1nhyA02 85.88 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 13 83 2.89 3.46
1aw9A02 85.66 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 15 84 2.18 2.58
1dugA02 85.58 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 15 78 2.18 2.76
1n2aA02 85.56 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 16 80 1.99 2.47
1eemA02 84.33 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 12 86 2.14 2.48
1k0oB02 84.08 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 12 79 2.17 2.72
2vo4A02 84.00 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 13 82 2.25 2.72
1gwcA02 83.27 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 16 82 2.29 2.78
2c3nA02 83.10 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 19 73 1.95 2.64
2gsqA02 82.11 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 11 77 2.43 3.15
3cbuA02 81.03 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 16 80 3.02 3.76
1gnwA02 80.60 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 9 84 3.31 3.94
[1]
Displaying entries 1 to 16 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jlvA02
KDDKLYPKDPQKRAVVNQRLYFDMGTLYQRFADYYYPQIFAKQPANAENEKKMKDAVDFLNTFLDGHKYVAGDSLTIADL
TVLATVSTYDVAGFELAKYPHVAAWYERTRKEAPGAAINEAGIEEFRKYF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jlvA02
KDDKLYPKDPQKRAVVNQRLYFDMGTLYQRFADYYYPQIFAKQPANAENEKKMKDAVDFLNTFLDGHKYVAGDSLTIADL
TVLATVSTYDVAGFELAKYPHVAAWYERTRKEAPGAAINEAGIEEFRKYFEK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:57

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"