CATH Domain: 1jl1A00 XML data for domain: 1jl1A00

Molscript image for 1jl1A00
1jl1A00
PDB coordinates for domain 1jl1A00

PDB 1jl1, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.10 Gene3D
3.30.420.10.2
3.30.420.10.2.1
3.30.420.10.2.1.1
3.30.420.10.2.1.1.1
3.30.420.10.2.1.1.1.1

[top]
Segment boundaries for domain 1jl1A00

Chopping figure for domain 1jl1A00
DomainStart PDB ResidueStop PDB Residue
1jl1A00 3 154

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.420.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3hyfA00 84.98 Human immunodeficiency virus 1Reverse transcriptase/RNaseH 3.30.420.10 141 34 85 3.80 4.44
2zd1A05 84.09 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.420.10 126 22 76 2.20 2.88
2rkiA05 83.72 HIV-1 M:B_HXB2RGag-Pol polyprotein 3.30.420.10 126 24 76 2.34 3.07
1lwcA05 77.18 HIV-1 M:B_HXB2RGag-Pol polyprotein 3.30.420.10 91 20 53 2.08 3.90
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jl1A00
KQVEIFTAGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQWI
HNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jl1A00
MLKQVEIFTAGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQ
WIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVEV
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"