CATH Domain: 1jkgA00 XML data for domain: 1jkgA00

Molscript image for 1jkgA00
1jkgA00
PDB coordinates for domain 1jkgA00

PDB 1jkg, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.15
3.10.450.50.15.1
3.10.450.50.15.1.1
3.10.450.50.15.1.1.1
3.10.450.50.15.1.1.1.1

Segment boundaries for domain 1jkgA00

Chopping figure for domain 1jkgA00
DomainStart PDB ResidueStop PDB Residue
1jkgA00 2 140

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.10.450.50.15.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1m98A02 85.11 Arthrospira maximaOrange carotenoid-binding protein 3.10.450.50 128 12 84 4.16 4.94
3cnxA00 84.21 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 14 84 2.31 2.72
1of5B00 84.00 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 8 89 3.24 3.63
1tuhA00 83.02 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 12 79 2.00 2.50
2owpA00 82.82 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 8 85 2.83 3.31
2ux0B00 82.50 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 8 88 3.49 3.94
2rgqB00 81.93 3.10.450.50 124 9 84 3.12 3.71
3bb9B00 81.50 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 9 82 3.34 4.04
1q40D00 81.16 MRNA export factor MEX67Candida albicans 3.10.450.50 169 17 68 2.83 4.12
1q42A00 81.13 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 13 77 2.98 3.85
3b7cA00 80.72 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 11 78 2.51 3.20
3cu3A00 80.09 Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102 3.10.450.50 160 12 75 3.24 4.32
3blzA00 80.06 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 16 84 2.76 3.28
Displaying entries 1 to 13 (page 1 of 1)


Domain ATOM Sequence

>pdb|1jkgA00
ASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVH
DEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS    

Domain COMBS Sequence

>pdb|1jkgA00
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPV
HDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS    

Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:17

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"