CATH Domain: 1jjoC02 XML data for domain: 1jjoC02

Molscript image for 1jjoC02
1jjoC02
PDB coordinates for domain 1jjoC02

PDB 1jjo, Chain C, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.39 Alpha-1-antitrypsin; domain 1
2.30.39.10 Alpha-1-antitrypsin, domain 1 Gene3D
2.30.39.10.14
2.30.39.10.14.1
2.30.39.10.14.1.1
2.30.39.10.14.1.1.2
2.30.39.10.14.1.1.2.1

[top]
Segment boundaries for domain 1jjoC02

Chopping figure for domain 1jjoC02
DomainStart PDB ResidueStop PDB Residue
1jjoC01 107 203
1jjoC01 290 356
1jjoC02 204 289

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.30.39.10.14.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hp7A01 88.36 Alpha-1-antitrypsinProtease bindingAlpha-1-antitrypsinHomo sapiensExtracellular space 2.30.39.10 95 21 91 2.04 2.22
1jmoA02 82.28 Heparin cofactor IIHomo sapiensHeparin cofactor 2Complement and coagulation cascades 2.30.39.10 150 27 63 2.01 3.17
1k9oI02 79.59 Manduca sextaAlaserpinProtein binding 2.30.39.10 161 22 59 2.07 3.47
1imvA01 78.92 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorCell proliferationPositive regulation of neurogenesis 2.30.39.10 169 19 56 2.11 3.75
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jjoC02
RTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEW
ANSVKKQKVEVYLP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jjoC02
RTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEW
ANSVKKQKVEVYLP
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 19 Nov 2008 14:18

Assigning to "2.30.39.10" based on similarity with "1jjoD02"

Flow stage update by auto on 19 Nov 2008 14:08

No in_process hits for Domain "1jjoC02" ready to be processed

Update comment by auto on 23 Jul 2008 18:03

Domain "1jjoC02" hits Domain "1jjoD02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:11

Domain "1jjoC02" hits Domain "1jjoD02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:17

Domain "1jjoC02" hits Domain "1jjoD02" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:44

Domain "1jjoC02" hits Domain "1jjoD02" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:08

Domain "1jjoC02" hits Domain "1jjoD02" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1jjoC02"

Flow stage update by auto on 14 Mar 2007 15:01

All required files are present for Domain "1jjoC02"

Flow stage update by auto on 14 Mar 2007 14:59

Beginning processing for Domain "1jjoC02"

Insertion by auto on 05 Mar 2006 23:24

Cut based on decision in database "DomChop" on "cathdb"