CATH Domain: 1jigA00 XML data for domain: 1jigA00

Molscript image for 1jigA00
1jigA00
PDB coordinates for domain 1jigA00

PDB 1jig, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.7
1.20.1260.10.7.1
1.20.1260.10.7.1.1
1.20.1260.10.7.1.1.1
1.20.1260.10.7.1.1.1.1

[top]
Segment boundaries for domain 1jigA00

Chopping figure for domain 1jigA00
DomainStart PDB ResidueStop PDB Residue
1jigA00 2 147

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fjcB00 93.35 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 35 93 1.06 1.13
3kwoA00 92.53 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 29 95 1.69 1.76
2yw6B00 91.10 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 26 96 1.54 1.59
3fvbA00 89.77 BacterioferritinBrucella melitensis biovar Abortus 2308Bacterioferritin 1.20.1260.10 161 18 85 2.04 2.40
1lkoA01 89.52 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 10 92 2.46 2.66
1tjoB00 89.22 DNA protection during starvation proteinHalobacterium salinarum 1.20.1260.10 175 30 83 1.59 1.91
2ib0A01 88.67 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 10 91 2.56 2.81
1nfvA00 88.48 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 18 81 2.03 2.49
1vlgA00 86.12 Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin 1.20.1260.10 164 13 84 2.64 3.14
2qf9A01 84.99 Putative secreted proteinStreptomyces coelicolor 1.20.1260.10 140 4 88 4.21 4.76
2oh3A01 84.79 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 9 84 2.71 3.22
3a9qE00 83.87 Ferritin-4, chloroplasticGlycine max 1.20.1260.10 168 12 78 3.07 3.91
1jkvA01 82.09 Lactobacillus plantarumManganese catalase 1.20.1260.10 197 12 69 2.63 3.78
2oc5A01 78.03 Prochlorococcus marinus str. MIT 9313Putative uncharacterized protein 1.20.1260.10 203 7 63 2.89 4.58
2rklB00 70.32 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 16 32 1.31 4.07
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jigA00
STKTNVVEVLNKQVANWNVLYVKLHNYHWYVTGPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATMKEYLATSS
VNEGTSKESAEEMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jigA00
STKTNVVEVLNKQVANWNVLYVKLHNYHWYVTGPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATMKEYLATSS
VNEGTSKESAEEMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:43

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"