Set cath from cathlist by auto on 05 Mar 2006 19:31
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1jgtB01 | 4 | 210 |
| 1jgtB02 | 211 | 505 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.60.20.10.16.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1ct9A01 | 82.13 | 3.60.20.10 | 192 | 16 | 85 | 3.07 | 3.60 |
>pdb|1jgtB01 PVLPAAFGFLASARTGGGPGPVFATRGSHTDIDTPQGERSLAATLVHAPSVAPDRAVARSLTGAPTTAVLAGEIYNRDEL LSVLPAGPAPEGDAELVLRLLERYDLHAFRLVNGRFATVVRTGDRVLLATDHAGSVPLYTCVAPGEVRASTEAKALAAHR DPKGFPLADARRVAGLTGVYQVPAGAVMDIDLGSGTAVTHRTWTP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"