CATH Domain: 1jg8A02 XML data for domain: 1jg8A02

Molscript image for 1jg8A02
1jg8A02
PDB coordinates for domain 1jg8A02

PDB 1jg8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.40
3.90.1150.10.40.1
3.90.1150.10.40.1.1
3.90.1150.10.40.1.1.1
3.90.1150.10.40.1.1.1.1

[top]
Segment boundaries for domain 1jg8A02

Chopping figure for domain 1jg8A02
DomainStart PDB ResidueStop PDB Residue
1jg8A01 5 250
1jg8A02 251 346

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.40.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1svvB02 85.12 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.90.1150.10 88 12 84 2.73 3.24
1m32A01 85.01 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 14 82 2.29 2.77
1iugA01 83.20 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 12 85 2.50 2.92
1uu2B01 82.50 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 19 71 2.12 2.95
1d2fB01 80.38 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.90.1150.10 124 15 75 2.95 3.89
1tplA01 76.75 Citrobacter freundiiTyrosine phenol-lyase 3.90.1150.10 181 16 52 2.07 3.94
1c4kA03 75.65 Lactobacillus sp. 30AOrnithine decarboxylase, inducible 3.90.1150.10 180 15 50 2.38 4.76
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jg8A02
MVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRN
DIEEALNIFEKLFRKF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jg8A02
MVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRN
DIEEALNIFEKLFRKF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:56

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"