Set cath from cathlist by auto on 05 Mar 2006 19:28
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1jg8A01 | 5 | 250 |
| 1jg8A02 | 251 | 346 |
There are 29 matching structural neighberhood comparisons for CATH ID 3.40.640.10.16.1.1.1.1 (SIMAX score < 5)
>pdb|1jg8A01 MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEA DSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKE HGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGI IALTK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"