CATH Domain: 1jfzA00 XML data for domain: 1jfzA00

Molscript image for 1jfzA00
1jfzA00
PDB coordinates for domain 1jfzA00

PDB 1jfz, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1520 Ribonuclease iii, N-terminal Endonuclease Domain; Chain A
1.10.1520.10 Gene3D
1.10.1520.10.1
1.10.1520.10.1.1
1.10.1520.10.1.1.1
1.10.1520.10.1.1.1.2
1.10.1520.10.1.1.1.2.1

[top]
Segment boundaries for domain 1jfzA00

Chopping figure for domain 1jfzA00
DomainStart PDB ResidueStop PDB Residue
1jfzA00 0 147

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1520.10.1.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o0wA01 88.72 Thermotoga maritimaRibonuclease 3Ribonuclease III [EC:3.1.26.3] 1.10.1520.10 154 32 89 2.15 2.40
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jfzA00
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEF
FNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jfzA00
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEF
FNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"