CATH Domain: 1jfbA00 XML data for domain: 1jfbA00

Molscript image for 1jfbA00
1jfbA00
PDB coordinates for domain 1jfbA00

PDB 1jfb, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.630 Cytochrome p450
1.10.630.10 Cytochrome p450 Gene3D
1.10.630.10.1
1.10.630.10.1.1
1.10.630.10.1.1.1
1.10.630.10.1.1.1.1
1.10.630.10.1.1.1.1.1

[top]
Segment boundaries for domain 1jfbA00

Chopping figure for domain 1jfbA00
DomainStart PDB ResidueStop PDB Residue
1jfbA00 5 403

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 1.10.630.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2zbxA00 88.02 Streptomyces griseolusCytochrome P450-SU1 1.10.630.10 398 35 95 2.18 2.28
1s1fA00 85.50 Biflaviolin synthase [EC:1.14.21.7]Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 397 26 96 2.76 2.87
2z3tA00 85.43 Cytochrome P450Streptomyces sp. TP-A0274 1.10.630.10 385 26 92 3.14 3.38
1n40A00 85.09 Naphthalene and anthracene degradationGamma-Hexachlorocyclohexane degradationLimonene and pinene degradationCytochrome P450 121[EC:1.14.-.-] 1.10.630.10 394 23 96 3.08 3.20
1odoA00 85.07 Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 395 26 97 3.20 3.28
1lfkA00 84.86 Amycolatopsis orientalisCytochrome P450 165B3 1.10.630.10 375 25 93 3.32 3.55
1t2bA00 84.44 Citrobacter braakiiP450cin 1.10.630.10 397 19 93 2.90 3.09
1cptA00 84.14 Pseudomonas sp.Cytochrome P450-terp 1.10.630.10 412 25 92 3.27 3.52
1q5dA00 83.83 Epothilone biosynthetic processCytochrome P450 167A1Sorangium cellulosum 1.10.630.10 401 24 94 3.24 3.42
2zwuA00 81.57 Camphor 5-monooxygenasePseudomonas putida 1.10.630.10 394 21 92 3.31 3.58
1n97A00 81.25 Thermus thermophilus HB27Cytochrome P450 1.10.630.10 385 13 88 3.36 3.79
1izoA00 80.51 Bacillus subtilisLimonene and pinene degradationNaphthalene and anthracene degradationGamma-Hexachlorocyclohexane degradationCytochrome P450 152A1 1.10.630.10 411 13 90 3.10 3.42
2ij2B00 79.92 Bacillus megateriumBifunctional P-450/NADPH-P450 reductase 1.10.630.10 448 12 84 3.69 4.37
1tqnA00 77.30 Vitamin D 24-hydroxylase activityCell surfaceSteroid bindingSteroid hormone biosynthesisMetabolic pathways 1.10.630.10 468 14 80 3.82 4.75
3czhA00 77.28 Vitamin D 25-hydroxylaseHomo sapiensCytochrome P450, family 2, subfamily R 1.10.630.10 465 13 81 3.52 4.31
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jfbA00
APSFPFSRASGPEPPAEFAKLRATNPVSQVKLFDGSLAWLVTKHKDVCFVATSEKLSKVRTRQGFPELSASGKQAAKAKP
TFVDMDPPEHMHQRSMVEPTFTPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPSYIIYTLLGVPFNDL
EYLTQQNAIRTNGSSTAREASAANQELLDYLAILVEQRLVEPKDDIISKLCTEQVKPGNIDKSDAVQIAFLLLVAGNATM
VNMIALGVATLAQHPDQLAQLKANPSLAPQFVEELCRYHTASALAIKRTAKEDVMIGDKLVRANEGIIASNQSANRDEEV
FENPDEFNMNRKWPPQDPLGFGFGDHRCIAEHLAKAELTTVFSTLYQKFPDLKVAVPLGKINYTPLNRDVGIVDLPVIF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jfbA00
TMASGAPSFPFSRASGPEPPAEFAKLRATNPVSQVKLFDGSLAWLVTKHKDVCFVATSEKLSKVRTRQGFPELSASGKQA
AKAKPTFVDMDPPEHMHQRSMVEPTFTPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPSYIIYTLLGV
PFNDLEYLTQQNAIRTNGSSTAREASAANQELLDYLAILVEQRLVEPKDDIISKLCTEQVKPGNIDKSDAVQIAFLLLVA
GNATMVNMIALGVATLAQHPDQLAQLKANPSLAPQFVEELCRYHTASALAIKRTAKEDVMIGDKLVRANEGIIASNQSAN
RDEEVFENPDEFNMNRKWPPQDPLGFGFGDHRCIAEHLAKAELTTVFSTLYQKFPDLKVAVPLGKINYTPLNRDVGIVDL
PVIF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:14

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:14

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:35

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"