CATH Domain: 1jceA01 XML data for domain: 1jceA01

Molscript image for 1jceA01
1jceA01
PDB coordinates for domain 1jceA01

PDB 1jce, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.13
3.30.420.40.13.1
3.30.420.40.13.1.1
3.30.420.40.13.1.1.1
3.30.420.40.13.1.1.1.1

[top]
Segment boundaries for domain 1jceA01

Chopping figure for domain 1jceA01
DomainStart PDB ResidueStop PDB Residue
1jceA01 4 139
1jceA01 312 328
1jceA02 146 176
1jceA02 254 311
1jceA03 178 253

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.420.40.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qxlB01 84.53 ATP bindingCytoplasmAdenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Peptide binding 3.30.420.40 134 23 73 2.94 4.00
3h1qA01 80.39 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 152 18 72 2.82 3.90
2hoeA02 79.96 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 146 12 76 3.74 4.91
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1jceA01
KDIGIDLGTANTLVFLRGKGIVVNEPSVIAIDSTTGEILKVGLEAKNIGKTPATIKAIRPRDGVIADYTVALVLRYFINK
AKGGNLFKPRVVIGVPIGITDVERRAILDAGLEAGASKVFLIEEPAAAIGSLTAVAKGAGVLDKVNI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1jceA01
MLRKDIGIDLGTANTLVFLRGKGIVVNEPSVIAIDSTTGEILKVGLEAKNXIGKTPATIKAIRPXRDGVIADYTVALVXL
RYFINKAKGGXNLFKPRVVIGVPIGITDVERRAILDAGLEAGASKVFLIEEPXAAAIGSLTAVAKGAGXVLDKVNI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:55

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"