Set cath from cathlist by auto on 05 Mar 2006 18:31
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1jb7A01 | 37 | 210 |
| 1jb7A02 | 211 | 326 |
| 1jb7A03 | 327 | 495 |
There are 15 matching structural neighberhood comparisons for CATH ID 2.40.50.140.12.1.1.1.1 (SIMAX score < 5)
>pdb|1jb7A02 YTALNKAQAQKGDFDVVAKILQVHELDEYTNELKLKDASGQVFYTLSLKLKFPHVRTGEVVRIRSATYDETSTQKKVLIL SHYSNIITFIQSSKLAKELRAKIQDDHSVEVASLKK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"