Set cath from cathlist by auto on 05 Mar 2006 19:05
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1jajA01 | 1 | 105 |
| 1jajA02 | 106 | 174 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1jajA01 MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKV CGERKCVLFIEWEKKTYQLDLFTAL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"