Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ja1A01 | 64 | 235 |
| 1ja1A02 | 271 | 324 |
| 1ja1A02 | 451 | 518 |
| 1ja1A03 | 325 | 450 |
| 1ja1A04 | 519 | 676 |
There are 8 matching structural neighberhood comparisons for CATH ID 2.40.30.10.12.1.1.1.1 (SIMAX score < 5)
>pdb|1ja1A02 NQKPPFDAKNPFLAAVTANRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPLQARYYAIASSSKVHPNSVHICAVAV EYEAKSGRVNKGVATSWLRAKEPAGENGGRALVPMFVRKSQF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"