CATH Domain: 1j98A00 XML data for domain: 1j98A00

Molscript image for 1j98A00
1j98A00
PDB coordinates for domain 1j98A00

PDB 1j98, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.80 Gene3D
3.30.1360.80.1
3.30.1360.80.1.1
3.30.1360.80.1.1.1
3.30.1360.80.1.1.1.1
3.30.1360.80.1.1.1.1.1

[top]
Segment boundaries for domain 1j98A00

Chopping figure for domain 1j98A00
DomainStart PDB ResidueStop PDB Residue
1j98A00 4 157

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1360.80.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j6wB00 90.31 Haemophilus influenzaeCysteine and methionine metabolismS-ribosylhomocysteine lyase [EC:4.4.1.21]S-ribosylhomocysteine lyase 3.30.1360.80 154 31 93 1.86 1.99
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1j98A00
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMG
QTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1j98A00
MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS
PMGXQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:33

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"