CATH Domain: 1j77A00 XML data for domain: 1j77A00

Molscript image for 1j77A00
1j77A00
PDB coordinates for domain 1j77A00

PDB 1j77, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.6
1.20.910.10.6.1
1.20.910.10.6.1.1
1.20.910.10.6.1.1.1
1.20.910.10.6.1.1.1.1

[top]
Segment boundaries for domain 1j77A00

Chopping figure for domain 1j77A00
DomainStart PDB ResidueStop PDB Residue
1j77A00 8 207

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.20.910.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1sk7A00 91.35 Pseudomonas aeruginosaHeme oxygenaseHeme oxygenase 1.20.910.10 187 35 92 1.36 1.47
1j02A00 84.08 DNA damage response, signal transduction resulting in induction of apoptosisRattus norvegicusRegulation of blood pressureNucleolusResponse to hydrogen peroxide 1.20.910.10 212 17 88 2.89 3.26
3bjdA02 77.00 Pseudomonas aeruginosaPutative uncharacterized protein 1.20.910.10 217 10 81 3.98 4.88
1rcwB00 76.12 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 12 84 3.89 4.59
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1j77A00
ALTFAKRLKADTTAVHDSVDNLVMSVQPFVSKENYIKFLKLQSVFHKAVDHIYKDAELNKAIPELEYMARYDAVTQDLKD
LGEEPYKFDKELPYEAGNKAIGWLYCAEGSNLGAAFLFKHAQKLDYNGEHGARHLAPHPDGRGKHWRAFVEHLNALNLTP
EAEAEAIQGAREAFAFYKVVLRETFGLAADAEAPEGMMPH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1j77A00
MSETENQALTFAKRLKADTTAVHDSVDNLVMSVQPFVSKENYIKFLKLQSVFHKAVDHIYKDAELNKAIPELEYMARYDA
VTQDLKDLGEEPYKFDKELPYEAGNKAIGWLYCAEGSNLGAAFLFKHAQKLDYNGEHGARHLAPHPDGRGKHWRAFVEHL
NALNLTPEAEAEAIQGAREAFAFYKVVLRETFGLAADAEAPEGMMPHRH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:19

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:19

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:41

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"