Flow stage update by cuff on 25 Apr 2006 18:50
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1j5xA01 | 2 | 169 |
| 1j5xA02 | 170 | 319 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1j5xA02 STERFSELVGYSPEFFDISWKVIEKIDLKEHDHFVFLGSEFFGVSLESALKCIESLTFSEAYSTLEYRHGPKALVKKGTL VFQKVSGDEQEKRLRKELESLGATVLEVGEGGDIPVSNDWKSAFLRTVPAQILGYQKAISRGISPD
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"