Flow stage update by cuff on 25 Apr 2006 18:50
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1j5xA01 | 2 | 169 |
| 1j5xA02 | 170 | 319 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.16.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1j5xA02 | 81.45 | 3.40.50.10490 | 146 | 10 | 84 | 3.26 | 3.86 |
>pdb|1j5xA01 SKTLKEITDQKNELKKFFENFVLNLEKITDEVLFVGCGSSYNLALTISYYFERVLKIRTKAIPAGEVAFQKIPDLEERGL AFLFSRTGNTTEVLLANDVLKKRNHRTIGITIEEESRLAKESDLPLVFPVREEAIVTKSFSILLSLFLADKIAGN
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"