Domain assigned by auto on 28 Apr 2006 18:10
Assigning to "3.30.930.10" based on similarity with "1j5wA01" (NWSI: 97.2222222222222, NWO: 100, SPS: 96.50, SPO: 97, RMSD: 0.81)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1j5wB01 | 2 | 204 |
| 1j5wB02 | 205 | 280 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1j5wB01 YLQDVIKLNDFWASKGCLLEQPYDEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTDGRYGENPNRLQRYFQYQVIIKP SPENSQELYLESLEYLGIKEHDIRFVEDNWESPTLGAWGVGWEVWLDGEITQFTYFQQIGGISLKDIPLEITYGLERIAY LQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEA
Assigning to "3.30.930.10" based on similarity with "1j5wA01" (NWSI: 97.2222222222222, NWO: 100, SPS: 96.50, SPO: 97, RMSD: 0.81)
NW result present for Domain "1j5wB01"
All required files are present for Domain "1j5wB01"
Beginning processing for Domain "1j5wB01"