CATH Domain: 1j3wC00 XML data for domain: 1j3wC00

Molscript image for 1j3wC00
1j3wC00
PDB coordinates for domain 1j3wC00

PDB 1j3w, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.30 Dynein light chain 2a, cytoplasmic Gene3D
3.30.450.30.2
3.30.450.30.2.1
3.30.450.30.2.1.1
3.30.450.30.2.1.1.1
3.30.450.30.2.1.1.1.1

[top]
Segment boundaries for domain 1j3wC00

Chopping figure for domain 1j3wC00
DomainStart PDB ResidueStop PDB Residue
1j3wC00 6 138

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.450.30.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vetB00 87.47 Mus musculusActivation of MAPKK activityMitogen-activated protein-binding protein-interacting proteinProtein binding 3.30.450.30 118 16 87 2.38 2.71
1vetA00 82.53 Mus musculusKinase activator activityMitogen-activated protein kinase scaffold protein 1Activation of MAPKK activityMAPK signaling pathway 3.30.450.30 122 10 90 2.85 3.16
2qybA00 81.54 Membrane protein, putativeGeobacter sulfurreducens 3.30.450.40 147 6 79 3.52 4.42
3bw6A00 80.46 Vesicle fusionSNAP receptor activitySoluble fractionPalmitoyltransferase activitySynaptobrevin homolog YKT6 3.30.450.50 137 9 74 3.21 4.31
1ifqB00 79.86 SNARE interactions in vesicular transportMus musculusVesicle-trafficking protein SEC22bGolgi membraneEndoplasmic reticulum membrane 3.30.450.50 125 4 74 2.75 3.69
3eeaA00 78.74 GAF domain/HD domain proteinGeobacter sulfurreducens 3.30.450.40 153 5 79 3.70 4.68
2vglS00 77.25 Huntington's diseaseEndocytosisMus musculusAP-2 complex subunit sigmaAP-2 complex subunit sigma-1 3.30.450.60 142 7 69 3.47 4.98
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1j3wC00
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVAGNAAATQALAKLLGEARFQEE
VHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRASEALARIAEEALA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1j3wC00
MVEPSLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVAGNAAATQALAKLLGEA
RFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRASEALARIAEEALA
BLAST against CATH

[top]
Domain History Events (6)

Classification merge by cuff on 27 Jun 2008 15:37

COMMENT: 1j3w unknown function/uncharacterised. However, SCOP puts these domains into the same superfamily and family. 1vet assembles into a dimer; 1j3w as a tetramer.
Same fold group but not convinced that these domains belong to the same superfamily FINAL: merge 3.30.450.110 -> 3.30.450.30

Domain assigned by auto on 28 Apr 2006 18:18

Assigning to "3.30.450.110" based on similarity with "1j3wA00" (NWSI: 100, NWO: 99.2805755395683, SPS: 98.74, SPO: 99, RMSD: 0.27)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1j3wC00"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1j3wC00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1j3wC00"

Insertion by auto on 08 Mar 2006 20:55

Final ChopClose added based on similarity with "1j3wA" [LEE: 0, LME: 0, MR: 1, LG: 1, SS: 98.74, SI: 100, SO: 99.2805755395683]