CATH Domain: 1j1lA02 XML data for domain: 1j1lA02

Molscript image for 1j1lA02
1j1lA02
PDB coordinates for domain 1j1lA02

PDB 1j1l, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.10 Jelly Rolls Gene3D
2.60.120.10.13
2.60.120.10.13.1
2.60.120.10.13.1.1
2.60.120.10.13.1.1.1
2.60.120.10.13.1.1.1.1

[top]
Segment boundaries for domain 1j1lA02

Chopping figure for domain 1j1lA02
DomainStart PDB ResidueStop PDB Residue
1j1lA01 3 13
1j1lA01 140 246
1j1lA02 14 139
1j1lA02 247 283

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 2.60.120.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1sefA02 78.34 Enterococcus faecalisPutative uncharacterized protein 2.60.120.10 119 8 73 2.84 3.88
1o4tA00 77.03 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 115 15 62 2.00 3.20
2p17A00 76.70 Geobacillus kaustophilusPirin-like protein 2.60.120.10 241 34 50 2.50 4.94
1j1lA01 74.83 PirinTranscription from RNA polymerase II promoterNucleusTranscription cofactor activityHomo sapiens 2.60.120.10 118 11 64 3.09 4.76
1vj2A00 74.67 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 114 16 63 2.65 4.16
1pmiA03 73.33 Amino sugar and nucleotide sugar metabolismMannose-6-phosphate isomerase [EC:5.3.1.8]Mannose-6-phosphate isomeraseFructose and mannose metabolismMetabolic pathways 2.60.120.10 119 8 60 2.91 4.81
2qjvA02 72.85 Metabolic pathwaysInositol phosphate metabolismSalmonella enterica subsp. enterica serovar Typhimurium5-deoxy-glucuronate isomerase [EC:5.3.1.-]Putative inner membrane protein 2.60.120.10 109 8 63 2.61 4.14
1sefA01 72.75 Enterococcus faecalisPutative uncharacterized protein 2.60.120.10 131 7 65 3.00 4.57
3bcwA01 72.66 Bordetella bronchisepticaPutative uncharacterized protein 2.60.120.10 93 10 54 2.57 4.75
1y9qA02 72.34 Vibrio choleraeTranscriptional regulator, HTH_3 family 2.60.120.10 90 12 57 2.64 4.61
2q30A01 71.07 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 2.60.120.10 85 16 52 2.59 4.90
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1j1lA02
REQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSAHEDFCGHTGKNPGDLQWTAG
RGILHAEPCSEEPAHGLQLWVNLRSSEKVEPQYQELKSEEIREPVIQHGPFVNTNEEISQAILDFRNAKNGFERAKT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1j1lA02
REQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSXAHEDFCGHTGKXNPGDLQWX
TAGRGILHAEXPCSEEPAHGLQLWVNLRSSEKXVEPQYQELKSEEIREPVIQHGPFVXNTNEEISQAILDFRNAKNGFER
AKT
BLAST against CATH

[top]
Domain History Events (41)

Domain assigned by cuff on 04 Aug 2008 13:20

same superfamily

Homcheck review by yan on 30 Jun 2008 16:10

high ssap score, nicely superposed, both metal-binding Cupin domains

Flow stage update by yan on 30 Jun 2008 16:10

high ssap score, nicely superposed, both metal-binding Cupin domains

Domain assignment manual match h by yan on 30 Jun 2008 16:10

high ssap score, nicely superposed, both metal-binding Cupin domains

Homcheck allotment by yan on 30 Jun 2008 16:05

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by yan on 30 Jun 2008 16:05

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 May 2008 22:26

Calculated SCOP results for 1j1lA02 and inserted them into the database.

Domain scan scop cath by auto on 06 May 2008 22:26

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 85 results for 1j1lA02

Flow stage update by auto on 28 Dec 2007 08:56

Retrieved PRC_PFAMCATH results for job ID SID6013735432393361 and results inserted.

Domain scan prc pfamcath by auto on 28 Dec 2007 08:55

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 97 results for 1j1lA02

Update comment by auto on 27 Dec 2007 21:03

PRC_PFAMCATH job SID6013735432393361 is not yet finished.

Flow stage update by auto on 27 Dec 2007 21:00

The entry "1j1lA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 27 Dec 2007 21:00

The entry "1j1lA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Dec 2007 20:46

Retrieved SSAP results for job ID SID7245551402282644 and results inserted.

Domain scan ssap cath by auto on 27 Dec 2007 20:45

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 518 results for 1j1lA02

Update comment by auto on 27 Dec 2007 00:15

SSAP job SID7245551402282644 is not yet finished.

Ssap cath submit by auto on 26 Dec 2007 23:41

The entry "1j1lA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Dec 2007 23:41

The entry "1j1lA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Dec 2007 23:39

Retrieved PRC results for job ID SID8788888632617040 and inserted them into the database.

Domain scan prc cath by auto on 26 Dec 2007 23:39

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 1j1lA02

Update comment by auto on 26 Dec 2007 17:24

PRC job SID8788888632617040 is not yet finished.

Prc cath submit by auto on 26 Dec 2007 17:22

The entry "1j1lA02" has been submitted to the PRC webservice.

Flow stage update by auto on 26 Dec 2007 17:22

The entry "1j1lA02" has been submitted to the PRC webservice.

Flow stage update by auto on 26 Dec 2007 17:20

Retrieved HMM(SAM) results for job ID SID5126888775940998 and inserted them into the database.

Domain scan sam cath by auto on 26 Dec 2007 17:20

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 1j1lA02

Update comment by auto on 26 Dec 2007 11:28

HMM(SAM) job SID5126888775940998 is not yet finished.

Sam cath submit by auto on 26 Dec 2007 11:26

The entry "1j1lA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Dec 2007 11:26

The entry "1j1lA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Dec 2007 11:24

Retrieved "1j1lA02" CATHEDRAL results for job ID SID6969008030532928 and inserted them into the database.

Domain scan cathedral cath by auto on 26 Dec 2007 11:23

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 113 results for 1j1lA02

Update comment by auto on 26 Dec 2007 05:27

"1j1lA02" CATHEDRAL job SID6969008030532928 is not yet finished.

Cathedral cath submit by auto on 26 Dec 2007 05:23

The entry "1j1lA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 26 Dec 2007 05:23

The entry "1j1lA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 26 Dec 2007 05:22

ScanList with 11656 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1j1lA02.scanlist" for "1j1lA02"

Write scan list by auto on 26 Dec 2007 05:22

Writing ScanList containing 11656 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1j1lA02.scanlist" for domain "1j1lA02"

Flow stage update by auto on 18 Aug 2007 06:19

No satisfactory AssignClose result found.

Flow stage update by auto on 18 Aug 2007 06:10

No in_process hits for Domain "1j1lA02" ready to be processed

Flow stage update by auto on 18 Aug 2007 06:10

NW result present for Domain "1j1lA02"

Flow stage update by auto on 16 Aug 2007 17:15

All required files are present for Domain "1j1lA02"

Flow stage update by auto on 16 Aug 2007 00:02

Beginning processing for Domain "1j1lA02"

Insertion by cuff on 15 Aug 2007 11:07

nice chopping