CATH Domain: 1j09A04 XML data for domain: 1j09A04

Molscript image for 1j09A04
1j09A04
PDB coordinates for domain 1j09A04

PDB 1j09, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.70 Gene3D
1.10.8.70.1
1.10.8.70.1.1
1.10.8.70.1.1.1
1.10.8.70.1.1.1.1
1.10.8.70.1.1.1.1.1

[top]
Segment boundaries for domain 1j09A04

Chopping figure for domain 1j09A04
DomainStart PDB ResidueStop PDB Residue
1j09A01 1 70
1j09A01 187 237
1j09A02 238 322
1j09A03 71 186
1j09A04 323 370
1j09A05 371 468

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.8.70.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tgrA00 80.42 Positive regulation of smooth muscle cell proliferationPositive regulation of DNA replicationPositive regulation of gene-specific transcriptionRegulation of multicellular organism growthPositive regulation of tyrosine phosphorylation of Stat5 protein 1.10.100.10 52 10 90 3.94 4.36
2fi1A02 78.94 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 10 62 2.58 4.13
1s26D01 75.42 Calcium signaling pathwayPhosphatidylinositol signaling systemOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 59 4 66 3.21 4.86
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1j09A04
SLEEVAERVKPFLREAGLSWESEAYLRRAVELMRPRFDTLKEFPEKAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1j09A04
SLEEVAERVKPFLREAGLSWESEAYLRRAVELMRPRFDTLKEFPEKAR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:53

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"