CATH Domain: 1j09A03 XML data for domain: 1j09A03

Molscript image for 1j09A03
1j09A03
PDB coordinates for domain 1j09A03

PDB 1j09, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.800 Glutamyl-tRNA Synthetase; domain 3
3.90.800.10 Glutamyl-tRNA Synthetase; Domain 3 Gene3D
3.90.800.10.1
3.90.800.10.1.1
3.90.800.10.1.1.1
3.90.800.10.1.1.1.1
3.90.800.10.1.1.1.1.1

[top]
Segment boundaries for domain 1j09A03

Chopping figure for domain 1j09A03
DomainStart PDB ResidueStop PDB Residue
1j09A01 1 70
1j09A01 187 237
1j09A02 238 322
1j09A03 71 186
1j09A04 323 370
1j09A05 371 468

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.800.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qtqA04 80.82 Aminoacyl-tRNA biosynthesisMetabolic pathwaysGlutaminyl-tRNA synthetaseGlutamine-tRNA ligase activityGlutaminyl-tRNA aminoacylation 3.90.800.10 109 21 75 3.54 4.67
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1j09A03
PDVGGPHGPYRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKGGYDGRARNIPPEEAEERARRGEPHVIRLKV
PRPGTTEVKDELRGVVVYDNQEIPDVVLLKSDGYPT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1j09A03
PDVGGPHGPYRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKGGYDGRARNIPPEEAEERARRGEPHVIRLKV
PRPGTTEVKDELRGVVVYDNQEIPDVVLLKSDGYPT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:53

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"