CATH Domain: 1j02A00 XML data for domain: 1j02A00

Molscript image for 1j02A00
1j02A00
PDB coordinates for domain 1j02A00

PDB 1j02, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.7
1.20.910.10.7.1
1.20.910.10.7.1.1
1.20.910.10.7.1.1.1
1.20.910.10.7.1.1.1.1

[top]
Segment boundaries for domain 1j02A00

Chopping figure for domain 1j02A00
DomainStart PDB ResidueStop PDB Residue
1j02A00 11 222

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 1.20.910.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1sk7A00 83.81 Pseudomonas aeruginosaHeme oxygenaseHeme oxygenase 1.20.910.10 187 18 87 2.48 2.84
1uddA00 82.70 Thiamine metabolismPyrococcus horikoshiiTranscriptional activator TenA [EC:3.5.99.2]218aa long hypothetical transcriptional regulator 1.20.910.10 215 8 94 3.90 4.11
1rcwB00 82.62 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 11 93 3.15 3.37
1rtwB00 81.92 Pyrococcus furiosusTranscriptional activator, putative 1.20.910.10 204 11 94 3.74 3.94
3bjdA02 80.57 Pseudomonas aeruginosaPutative uncharacterized protein 1.20.910.10 217 10 90 3.94 4.34
2f2gA00 79.22 Seed maturation protein PM36 homologArabidopsis thaliana 1.20.910.10 211 7 94 4.63 4.88
3hlxA00 77.41 Pyrroloquinoline-quinone synthase [EC:1.3.3.11]Klebsiella pneumoniae subsp. pneumoniae MGH 78578Pyrroloquinoline-quinone synthase 1.20.910.10 247 10 80 3.42 4.27
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1j02A00
QDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALE
QDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFP
SIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1j02A00
MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFP
EELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSS
GEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:19

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:19

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"