Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1iz2A01 | 195 | 289 |
| 1iz2A01 | 359 | 394 |
| 1iz2A02 | 24 | 194 |
| 1iz2A02 | 290 | 358 |
There are 3 matching structural neighberhood comparisons for CATH ID 2.30.39.10.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1hp7A01 | 87.33 | 2.30.39.10 | 95 | 100 | 72 | 2.07 | 2.85 | |
![]() |
1lj5A02 | 83.96 | 2.30.39.10 | 154 | 29 | 81 | 2.54 | 3.13 | |
![]() |
2h4pA02 | 81.03 | 2.30.39.10 | 102 | 22 | 71 | 3.27 | 4.56 |
>pdb|1iz2A01 ERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITK FLENEDRRSASLHLPSIPPEAKFNKPFVFLIIDQNTKAPLFMGRVVNPTQK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"