CATH Domain: 1iyuA00 XML data for domain: 1iyuA00

Molscript image for 1iyuA00
1iyuA00
PDB coordinates for domain 1iyuA00

PDB 1iyu, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.50 OB fold (Dihydrolipoamide Acetyltransferase, E2P)
2.40.50.100 Gene3D
2.40.50.100.17
2.40.50.100.17.1
2.40.50.100.17.1.1
2.40.50.100.17.1.1.1
2.40.50.100.17.1.1.1.1

[top]
Segment boundaries for domain 1iyuA00

Chopping figure for domain 1iyuA00
DomainStart PDB ResidueStop PDB Residue
1iyuA00 1 79

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.40.50.100.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1labA00 84.67 Geobacillus stearothermophilusDihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex 2.40.50.100 80 25 93 2.76 2.94
1fycA00 73.02 Citrate cycle (TCA cycle)Pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]Glycolysis / GluconeogenesisPyruvate metabolismHomo sapiens 2.40.50.100 106 15 74 3.49 4.68
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iyuA00
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iyuA00
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1iyu000" to "1iyuA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:30

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:30

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:51

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"