CATH Domain: 1iynA02 XML data for domain: 1iynA02

Molscript image for 1iynA02
1iynA02
PDB coordinates for domain 1iynA02

PDB 1iyn, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.420 Peroxidase; domain 2
1.10.420.10 Peroxidase, domain 2 Gene3D
1.10.420.10.3
1.10.420.10.3.1
1.10.420.10.3.1.1
1.10.420.10.3.1.1.1
1.10.420.10.3.1.1.1.1

[top]
Segment boundaries for domain 1iynA02

Chopping figure for domain 1iynA02
DomainStart PDB ResidueStop PDB Residue
1iynA01 1 130
1iynA01 255 275
1iynA02 131 254

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.420.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ccaA02 87.30 Methane metabolismPhenylalanine metabolismTryptophan metabolismMetabolic pathwaysCatalase/peroxidase [EC:1.11.1.6 1.11.1.7] 1.10.420.10 133 25 75 1.24 1.63
1bgpA02 86.56 Hordeum vulgarePeroxidase BP 1 1.10.420.10 136 21 80 3.71 4.63
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iynA02
PDAGPPSPAQHLRDVFYRMGLNDKEIVALSGAHTLGRSRPDRSGWGKPETKYTKDGPGAPGGQSWTAQWLKFDNSYFKDI
KERRDEDLLVLPTDAALFEDPSFKVYAEKYAADPEAFFKDYAEA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iynA02
PDAGPPSPAQHLRDVFYRMGLNDKEIVALSGAHTLGRSRPDRSGWGKPETKYTKDGPGAPGGQSWTAQWLKFDNSYFKDI
KERRDEDLLVLPTDAALFEDPSFKVYAEKYAADPEAFFKDYAEA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:53

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"