Set cath from cathlist by auto on 05 Mar 2006 18:08
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1iynA01 | 1 | 130 |
| 1iynA01 | 255 | 275 |
| 1iynA02 | 131 | 254 |
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.420.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2ccaA02 | 87.30 | 1.10.420.10 | 133 | 25 | 75 | 1.24 | 1.63 | |
![]() |
1bgpA02 | 86.56 | 1.10.420.10 | 136 | 21 | 80 | 3.71 | 4.63 |
>pdb|1iynA02 PDAGPPSPAQHLRDVFYRMGLNDKEIVALSGAHTLGRSRPDRSGWGKPETKYTKDGPGAPGGQSWTAQWLKFDNSYFKDI KERRDEDLLVLPTDAALFEDPSFKVYAEKYAADPEAFFKDYAEA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"