Set cath from cathlist by auto on 05 Mar 2006 19:36
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 2 matching structural neighberhood comparisons for CATH ID 3.90.730.10.4.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1jy5A00 | 89.59 | 3.90.730.10 | 203 | 32 | 93 | 3.55 | 3.79 | |
![]() |
1bolA00 | 85.44 | 3.90.730.10 | 222 | 27 | 81 | 2.63 | 3.23 |
>pdb|1iybA00 YVEFAQDFDFFYFVQQWPGSYCDTKQSCCYPKTGKPASDFGIHGLWPNNNDGSYPSNCDSNSPYDQSQVSDLISRMQQNW PTLACPSGTGSAFWSHEWEKHGTCAENVFDQHGYFKKALDLKNQINLLEILQGAGIHPDGGFYSLNSIKNAIRSAIGYAP GIECNVDESGNSQLYQIYICVDGSGSNLIECPIFPRGKCGSSIEFPTF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"