Set cath from cathlist by auto on 05 Mar 2006 18:19
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ivhA01 | 9 | 130 |
| 1ivhA02 | 131 | 250 |
| 1ivhA03 | 251 | 391 |
There are 4 matching structural neighberhood comparisons for CATH ID 1.20.140.10.11.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2cj4A00 | 78.96 | 1.20.140.40 | 147 | 5 | 77 | 3.84 | 4.95 | |
![]() |
1u8vB03 | 78.10 | 1.20.140.10 | 213 | 10 | 63 | 2.40 | 3.76 | |
![]() |
1sj8A02 | 77.49 | 1.20.1440.10 | 122 | 8 | 83 | 4.14 | 4.95 | |
![]() |
1p49A02 | 69.87 | 1.10.287.550 | 59 | 3 | 37 | 1.87 | 4.97 |
>pdb|1ivhA03 LDLERLVLAGGPLGLMQAVLDHTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACDEGHCTAKDCAG VILYSAECATQVALDGIQCFGGNGYINDFPMGRFLRDAKLYEIGAGTSEVRRLVIGRAFNA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"