Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1iv8A01 | 1 | 87 |
| 1iv8A01 | 207 | 285 |
| 1iv8A01 | 419 | 459 |
| 1iv8A01 | 557 | 654 |
| 1iv8A02 | 88 | 205 |
| 1iv8A03 | 305 | 389 |
| 1iv8A04 | 460 | 556 |
| 1iv8A05 | 655 | 720 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1iv8A02 PNHMAVNSLNWRLMDVLMGSYYTYFDFFPEDDKIRLPILGEDLDTVISKGLLKIVKDGDEYFLEYFKWKLPLTEVGNDIY DTLQKQNYTLMSWKNPPSYRRFFDVNTLIGVNVE
HomCheck 'New T' domains
HomCheck 'New T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"