CATH Domain: 1iugA01 XML data for domain: 1iugA01

Molscript image for 1iugA01
1iugA01
PDB coordinates for domain 1iugA01

PDB 1iug, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.42
3.90.1150.10.42.1
3.90.1150.10.42.1.1
3.90.1150.10.42.1.1.1
3.90.1150.10.42.1.1.1.1

[top]
Segment boundaries for domain 1iugA01

Chopping figure for domain 1iugA01
DomainStart PDB ResidueStop PDB Residue
1iugA01 2 12
1iugA01 250 349
1iugA02 13 249

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.42.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1m32A01 88.51 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 20 93 1.90 2.03
1svvB02 81.96 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.90.1150.10 88 18 78 3.40 4.34
1uu2B01 81.29 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 10 81 2.64 3.25
1rv3A01 76.46 Oryctolagus cuniculusSerine hydroxymethyltransferase, cytosolic 3.90.1150.10 170 11 59 2.85 4.80
1tplA01 75.07 Citrobacter freundiiTyrosine phenol-lyase 3.90.1150.10 181 12 59 2.62 4.39
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iugA01
DWLLTPGPVRLLEEHLALKAWQNALLYGVGEEGGLRPVPKRFSPAVAAFYLPEGVPYARVKEAFAQRGAVIAGGQGPLKG
KVFRLSLMGAYDRYEALGVAGMFREVLEEIL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iugA01
MDWLLTPGPVRLLEEHLALKAWQNALLYGVGEEGGLRPVPKRFSPAVAAFYLPEGVPYARVKEAFAQRGAVIAGGQGPLK
GKVFRLSLMGAYDRYEALGVAGMFREVLEEILPAS
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:23

Cut based on decision in database "DomChop" on "cathdb"